RetrogeneDB ID: | retro_rnor_2479 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 7:132701471..132701802(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Rap1b | ||
Ensembl ID: | ENSRNOG00000007048 | ||
Aliases: | None | ||
Description: | Ras-related protein Rap-1b [Source:UniProtKB/Swiss-Prot;Acc:Q62636] |
Percent Identity: | 69.3 % |
Parental protein coverage: | 58.7 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | YRKQV-EVDAQQCMLEILDTAGTEQFTAMR-DLYMKNGQGFALVYSITAQSTFN-DLQDLRE---QILRV |
Y.K....VD.QQCMLEIL.TAGTEQFT....DLY.K.GQGFALV.SIT..ST....L.DL.....QILRV | |
Retrocopy | YNKEILHVDMQQCMLEILETAGTEQFTQLE<DLYIKTGQGFALV*SIT-DSTMH<HLKDLHDLREQILRV |
Parental | KDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESS |
KDTD.VPM.LVGNKCDLEDER.VGKEQGQN..RQ..NC.FLE.S | |
Retrocopy | KDTDGVPMTLVGNKCDLEDERLVGKEQGQNVVRQ*NNCVFLEFS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 53 .13 RPM |
SRP017611_kidney | 0 .00 RPM | 101 .46 RPM |
SRP017611_liver | 0 .00 RPM | 39 .87 RPM |
Species | RetrogeneDB ID |
---|---|
Mus musculus | retro_mmus_1370 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008637 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000008272 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000019724 | 18 retrocopies | |
Erinaceus europaeus | ENSEEUG00000010052 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000000242 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000025649 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000016460 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000013148 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000011442 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000029552 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000005746 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000004751 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005197 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000007048 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000016611 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000023079 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000032463 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000021148 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000030014 | 2 retrocopies |