RetrogeneDB ID: | retro_sscr_102 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 1:32198217..32198610(+) | ||
| Located in intron of: | ENSSSCG00000004166 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RHOQ | ||
| Ensembl ID: | ENSSSCG00000008439 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 62.5 % |
| Parental protein coverage: | 63.03 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
| Parental | QEDYDRLRPLSYPMTDVFL-ICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPK-TLAR |
| QED.D.LR.LS.P..DV.L..CFSV.N.ASFQNVKEE.VPELK.Y..N.PF.LIGTQI.L..DPK.T.AR | |
| Retrocopy | QEDCDHLRLLSCPVIDVLL<TCFSVENLASFQNVKEE*VPELKKYT*NIPFILIGTQIHL*GDPK<TIAR |
| Parental | LNDMKEKPICVEQGQKLAKEIGACCYVECSALTQK-GLKTVFDEAIIAILTPKKHTVKKRIGSRCI |
| L.D.K....C.EQG.KLA.E.GACC.V.CS..T...G...VF.E.IIAILTPKKHTV....G..C. | |
| Retrocopy | LKDTKGEAMCLEQGWKLANEMGACCQVVCSTVTHQ<GIE-VFGEVIIAILTPKKHTVXXXXGLGCV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 10 .35 RPM |
| SRP014902_testis | 0 .00 RPM | 9 .05 RPM |
| SRP018288_heart | 0 .00 RPM | 104 .01 RPM |
| SRP018288_kidney | 0 .00 RPM | 6 .60 RPM |
| SRP018288_liver | 0 .00 RPM | 1 .44 RPM |
| SRP018288_lung | 0 .00 RPM | 32 .28 RPM |
| SRP018856_adipose | 0 .11 RPM | 19 .91 RPM |
| SRP035408_brain | 0 .06 RPM | 24 .20 RPM |
| SRP035408_liver | 0 .00 RPM | 4 .76 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006082 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000000549 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000685 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000015226 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019234 | 3 retrocopies | |
| Felis catus | ENSFCAG00000015608 | 1 retrocopy | |
| Homo sapiens | ENSG00000119729 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000004327 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000009124 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000001567 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000033272 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012439 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000013691 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000015415 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000003520 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000008439 | 1 retrocopy |
retro_sscr_102 ,
|
| Sus scrofa | ENSSSCG00000021944 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000002837 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000011892 | 1 retrocopy |