RetrogeneDB ID: | retro_sscr_907 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 7:73344557..73344776(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSSSCG00000024776 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 64.47 % |
| Parental protein coverage: | 97.37 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | MSKAHPPELKKF-MDKKLSLKLNGGRHVQGILR-GFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSII |
| ...AHP.E.KK...DKKLSLK...G.HVQGIL..GFDPFMNL.ID.C.EMAT.G..NN..M..I..NSII | |
| Retrocopy | VNRAHPAEVKKM>VDKKLSLKSSSG-HVQGILG<GFDPFMNLAIDDCAEMATTG*ENNTKMAIIQENSII |
| Parental | MLEALE |
| ML.ALE | |
| Retrocopy | ML*ALE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 6 .90 RPM |
| SRP014902_testis | 0 .00 RPM | 37 .34 RPM |
| SRP018288_heart | 0 .00 RPM | 19 .44 RPM |
| SRP018288_kidney | 0 .00 RPM | 26 .60 RPM |
| SRP018288_liver | 0 .16 RPM | 22 .23 RPM |
| SRP018288_lung | 0 .10 RPM | 17 .00 RPM |
| SRP018856_adipose | 0 .00 RPM | 28 .92 RPM |
| SRP035408_brain | 0 .00 RPM | 11 .85 RPM |
| SRP035408_liver | 0 .00 RPM | 21 .81 RPM |