RetrogeneDB ID: | retro_ttru_268 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | GeneScaffold_1736:50046..50470(+) | ||
| Located in intron of: | ENSTTRG00000005348 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5G3 | ||
| Ensembl ID: | ENSTTRG00000011524 | ||
| Aliases: | None | ||
| Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) [Source:HGNC Symbol;Acc:843] |
| Percent Identity: | 62.68 % |
| Parental protein coverage: | 99.29 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | FACAKLACTPALIRAGSRVAYRPISASVLSRPEARTGESSTVFNGAQNGVSQLI-QREFQTSAVSRDIDT |
| .A.AK...T..LI...S.......S...L...E..T.ES.............LI....FQTSA.SRDIDT | |
| Retrocopy | YAYAKFVSTSSLIKRTSALLS*SLSTVMLKQ*ETLTDESHSSLAAPSPLTTSLIPSHTFQTSAISRDIDT |
| Parental | AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNRSLKQQLFSYAILGF-ALSEAMGLFCLMVAFLILF |
| ..KF.GAGAATVGVAGSGAGIGTVFGSLIIGYARN.SLKQQLF..AILGF.ALS.AMGLFCLM.AFLILF | |
| Retrocopy | ETKFTGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFFCAILGF>ALSVAMGLFCLMLAFLILF |
| Parental | AM |
| AM | |
| Retrocopy | AM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002944 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000013366 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000012592 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000008207 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000010440 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000010768 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012822 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003954 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000009520 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000012159 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000008526 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000011524 | 3 retrocopies |
retro_ttru_268 , retro_ttru_510, retro_ttru_588,
|