RetrogeneDB ID: | retro_btau_434 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 11:39931630..39931928(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL28 | ||
| Ensembl ID: | ENSBTAG00000023343 | ||
| Aliases: | None | ||
| Description: | 60S ribosomal protein L28 [Source:UniProtKB/Swiss-Prot;Acc:Q3T0L7] |
| Percent Identity: | 51.43 % |
| Parental protein coverage: | 74.45 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 2 |
| Parental | MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTV-GVEPAADGKGV-VVVMKRRS |
| ...HLQ.MV...CS.FLIK...Q...T..NNLKA..SF..N.LI..K...G.EPAADG.G....V.K.RS | |
| Retrocopy | LATHLQ*MVLWRCSNFLIKKGDQI*DTHLNNLKAHSSFHCN*LIGHKAM<GMEPAADG*GA<LEVAKWRS |
| Parental | GQRKPATSYVRTTINKN-ARATLSSIRHMIRKNKY |
| G....A.S...TT..KN...ATLSSI.H.I.K.KY | |
| Retrocopy | GL---ASSCMQTTASKNYSPATLSSIQHVICKDKY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 35 .69 RPM |
| ERP005899_muscle | 0 .00 RPM | 573 .98 RPM |
| SRP017611_brain | 0 .00 RPM | 55 .04 RPM |
| SRP017611_kidney | 0 .00 RPM | 98 .51 RPM |
| SRP017611_liver | 0 .00 RPM | 110 .70 RPM |
| SRP030211_testis | 0 .00 RPM | 104 .82 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000015980 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000003764 | 15 retrocopies | |
| Bos taurus | ENSBTAG00000023343 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000869 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012833 | 2 retrocopies | |
| Felis catus | ENSFCAG00000005639 | 15 retrocopies | |
| Macropus eugenii | ENSMEUG00000015744 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000023789 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015901 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000275 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000030432 | 10 retrocopies | |
| Ochotona princeps | ENSOPRG00000000463 | 1 retrocopy | |
| Petromyzon marinus | ENSPMAG00000008617 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010417 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000017127 | 5 retrocopies |