RetrogeneDB ID: | retro_btau_891 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 2:120314095..120314500(-) | ||
Located in intron of: | ENSBTAG00000005207 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL28 | ||
Ensembl ID: | ENSBTAG00000023343 | ||
Aliases: | None | ||
Description: | 60S ribosomal protein L28 [Source:UniProtKB/Swiss-Prot;Acc:Q3T0L7] |
Percent Identity: | 51.47 % |
Parental protein coverage: | 97.81 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | HLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVV-VVMKRRSGQRK |
HL..M..RNCSSFLIKRN...Y...P......NSF.YNGL.........PAA.GKG....VM..R.GQ.K | |
Retrocopy | HLHGMIQRNCSSFLIKRNEHMYNPSPVT*RP-NSFCYNGLTNSRAISMKPAANGKGMCPTVMN*RTGQQK |
Parental | PATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQ-KPVMVKRKPSRPTKSS |
..T....TTI.K.ARATLSSI.H.I.KNK..PDL.MAA..RA...L..Q.....V.RKP....KSS | |
Retrocopy | SVTPLMWTTIDKKARATLSSIMHLILKNKDHPDLYMAAFSRAGVTLGNQERALTV*RKPAFHSKSS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 35 .69 RPM |
ERP005899_muscle | 0 .00 RPM | 573 .98 RPM |
SRP017611_brain | 0 .05 RPM | 55 .04 RPM |
SRP017611_kidney | 0 .06 RPM | 98 .51 RPM |
SRP017611_liver | 0 .00 RPM | 110 .70 RPM |
SRP030211_testis | 0 .05 RPM | 104 .82 RPM |
Species | RetrogeneDB ID |
---|---|
Canis familiaris | retro_cfam_1192 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000015980 | 1 retrocopy | |
Ailuropoda melanoleuca | ENSAMEG00000003764 | 15 retrocopies | |
Bos taurus | ENSBTAG00000023343 | 5 retrocopies | |
Callithrix jacchus | ENSCJAG00000000869 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012833 | 2 retrocopies | |
Felis catus | ENSFCAG00000005639 | 15 retrocopies | |
Macropus eugenii | ENSMEUG00000015744 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000023789 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015901 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000275 | 1 retrocopy | |
Mus musculus | ENSMUSG00000030432 | 10 retrocopies | |
Ochotona princeps | ENSOPRG00000000463 | 1 retrocopy | |
Petromyzon marinus | ENSPMAG00000008617 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000010417 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000017127 | 5 retrocopies |