RetrogeneDB ID: | retro_cjac_1556 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 17:48261606..48261843(+) | ||
| Located in intron of: | ENSCJAG00000003617 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C8orf59 | ||
| Ensembl ID: | ENSCJAG00000000379 | ||
| Aliases: | None | ||
| Description: | chromosome 8 open reading frame 59 [Source:HGNC Symbol;Acc:32235] |
| Percent Identity: | 60.49 % |
| Parental protein coverage: | 80.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | KSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEKINRVNKAFVDVQKE-LAHFSKGLSLDPLQKELI |
| KS..V.H.AS..NF...NKAK..TTNL...NI.N.EK...V.K.FV..QK..LAHFSKGLSL.PLQK.LI | |
| Retrocopy | KSSSVYHMAS*TNFRVRNKAKAITTNLT--NILNIEKVSKVDKVFVHIQKKKLAHFSKGLSLEPLQKQLI |
| Parental | PQRRHESKPVN |
| .Q..HE..PVN | |
| Retrocopy | LQQHHENEPVN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .11 RPM | 3 .93 RPM |
| SRP051959_heart | 0 .04 RPM | 11 .79 RPM |
| SRP051959_kidney | 0 .04 RPM | 7 .21 RPM |
| SRP051959_liver | 0 .11 RPM | 6 .65 RPM |
| SRP051959_lung | 0 .13 RPM | 7 .26 RPM |
| SRP051959_lymph_node | 0 .11 RPM | 7 .01 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 11 .44 RPM |
| SRP051959_spleen | 0 .02 RPM | 7 .16 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2609 |
| Pan troglodytes | retro_ptro_1759 |
| Gorilla gorilla | retro_ggor_1828 |
| Pongo abelii | retro_pabe_2345 |
| Macaca mulatta | retro_mmul_1475 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
| Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
| Homo sapiens | ENSG00000176731 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |