RetrogeneDB ID: | retro_ptro_2982 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | GL390259.1:3604..3884(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C8orf59 | ||
| Ensembl ID: | ENSPTRG00000020385 | ||
| Aliases: | None | ||
| Description: | chromosome 8 open reading frame 59 [Source:HGNC Symbol;Acc:32235] |
| Percent Identity: | 67.71 % |
| Parental protein coverage: | 93.0 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
| Parental | MAKNKLRGP-KSRNVFHIASQK-NFKAKNKAKPVTTNLKKINIMNEEKVNRVNKAFVNVQKELAHFAKSI |
| M.KNKLR...K.RNVFHIASQK..FK.KNKA.PVTTNLKKINIMN...VN..NKAFVN.QKEL.H..K.. | |
| Retrocopy | MDKNKLREK<KARNVFHIASQK>HFKTKNKATPVTTNLKKINIMND*EVNKLNKAFVNIQKELVHCSKGL |
| Parental | SLEPLQKELIPQQRHESKP-VNVDEA |
| S.EPLQK....QQ..E..P.VN.DEA | |
| Retrocopy | SVEPLQK**ASQQHDEIEP>VNTDEA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .31 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 4 .80 RPM |
| SRP007412_heart | 0 .00 RPM | 11 .92 RPM |
| SRP007412_kidney | 0 .00 RPM | 14 .46 RPM |
| SRP007412_liver | 0 .00 RPM | 9 .20 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .33 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
| Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
| Homo sapiens | ENSG00000176731 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |