RetrogeneDB ID: | retro_cpor_962 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_37:19984327..19984608(+) | ||
Located in intron of: | ENSCPOG00000003527 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCPOG00000021965 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 68.75 % |
Parental protein coverage: | 95. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | KLRGQKSKNVFQIANQKTFKSKNKAKPVTTNLKKINIVNDEKIRRMNNAFVNIQKELAHFSKKLTLEPRH |
..R.Q.SK.VFQIAN.....SK.KAKPVTT.LK..NIVND.K....NNAFVNIQKELAHFSK.L.LEP.. | |
Retrocopy | RVREQTSKQVFQIANKESL-SKSKAKPVTTALKQTNIVNDGKVHTVNNAFVNIQKELAHFSKRLSLEPLQ |
Parental | KVRVNRQHPENEPVNVDE-AARLMAQ |
K...N.QHPENEPVNV.E..ARLMAQ | |
Retrocopy | KELINQQHPENEPVNVEE<GARLMAQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .23 RPM | 5 .58 RPM |
SRP017611_kidney | 0 .10 RPM | 14 .66 RPM |
SRP017611_liver | 0 .04 RPM | 13 .23 RPM |
SRP040447_lung | 0 .08 RPM | 8 .75 RPM |
SRP040447_skeletal_muscle | 0 .03 RPM | 5 .32 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
Homo sapiens | ENSG00000176731 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |