RetrogeneDB ID: | retro_cpor_962 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_37:19984327..19984608(+) | ||
| Located in intron of: | ENSCPOG00000003527 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCPOG00000021965 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.75 % |
| Parental protein coverage: | 95.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KLRGQKSKNVFQIANQKTFKSKNKAKPVTTNLKKINIVNDEKIRRMNNAFVNIQKELAHFSKKLTLEPRH |
| ..R.Q.SK.VFQIAN.....SK.KAKPVTT.LK..NIVND.K....NNAFVNIQKELAHFSK.L.LEP.. | |
| Retrocopy | RVREQTSKQVFQIANKESL-SKSKAKPVTTALKQTNIVNDGKVHTVNNAFVNIQKELAHFSKRLSLEPLQ |
| Parental | KVRVNRQHPENEPVNVDE-AARLMAQ |
| K...N.QHPENEPVNV.E..ARLMAQ | |
| Retrocopy | KELINQQHPENEPVNVEE<GARLMAQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .23 RPM | 5 .58 RPM |
| SRP017611_kidney | 0 .10 RPM | 14 .66 RPM |
| SRP017611_liver | 0 .04 RPM | 13 .23 RPM |
| SRP040447_lung | 0 .08 RPM | 8 .75 RPM |
| SRP040447_skeletal_muscle | 0 .03 RPM | 5 .32 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
| Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
| Homo sapiens | ENSG00000176731 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |