RetrogeneDB ID: | retro_mmus_257 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 3:106034709..106035003(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000092072 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | 1810022K09Rik | ||
Ensembl ID: | ENSMUSG00000078784 | ||
Aliases: | 1810022K09Rik, AI746582, AL023036 | ||
Description: | RIKEN cDNA 1810022K09 gene [Source:MGI Symbol;Acc:MGI:1916376] |
Percent Identity: | 100. % |
Parental protein coverage: | 69.78 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAKNKLKGQKSRNVFHIASHKTFKAKNKAKPVTTNLKKINIMNHEKVNRMNRAFVNIQKELANFSKSLSL |
MAKNKLKGQKSRNVFHIASHKTFKAKNKAKPVTTNLKKINIMNHEKVNRMNRAFVNIQKELANFSKSLSL | |
Retrocopy | MAKNKLKGQKSRNVFHIASHKTFKAKNKAKPVTTNLKKINIMNHEKVNRMNRAFVNIQKELANFSKSLSL |
Parental | KSVQKELKHHENEPANVDEATRLMAQL |
KSVQKELKHHENEPANVDEATRLMAQL | |
Retrocopy | KSVQKELKHHENEPANVDEATRLMAQL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 1 .26 RPM | 6 .28 RPM |
SRP007412_cerebellum | 0 .52 RPM | 3 .60 RPM |
SRP007412_heart | 1 .25 RPM | 2 .83 RPM |
SRP007412_kidney | 0 .87 RPM | 4 .99 RPM |
SRP007412_liver | 1 .09 RPM | 5 .16 RPM |
SRP007412_testis | 0 .59 RPM | 1 .33 RPM |
TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
---|---|---|---|---|---|---|
no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
TSS #1 | TSS_90888 | 11 libraries | 4 libraries | 25 libraries | 33 libraries | 999 libraries |
TSS #2 | TSS_90889 | 564 libraries | 436 libraries | 70 libraries | 1 library | 1 library |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
Homo sapiens | ENSG00000176731 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
Mus musculus | ENSMUSG00000078784 | 3 retrocopies |
retro_mmus_257 , retro_mmus_2950, retro_mmus_3313,
|
Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |