RetrogeneDB ID: | retro_cjac_1832 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 2:111746328..111746546(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP5 | ||
| Ensembl ID: | ENSCJAG00000000444 | ||
| Aliases: | None | ||
| Description: | fatty acid binding protein 5 (psoriasis-associated) [Source:HGNC Symbol;Acc:3560] |
| Percent Identity: | 75.68 % |
| Parental protein coverage: | 53.73 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | QFSCTLGEKFEETTADGRKTQ-TVCNFTDGALVQHQEWDGKESTITR-KLKDGKLVVDCVINNVTCTRIY |
| QFSCTLGEKFEETTAD.RK.Q.TVCNFT.G.LVQHQEW.GKE.TI.R..LK.GKL.V.C..NNVTCT... | |
| Retrocopy | QFSCTLGEKFEETTADSRKSQ>TVCNFTYGTLVQHQEWKGKERTIIR>RLKNGKLMVVCILNNVTCT*VC |
| Parental | EKVE |
| EKVE | |
| Retrocopy | EKVE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 4 .68 RPM |
| SRP051959_heart | 0 .00 RPM | 17 .70 RPM |
| SRP051959_kidney | 0 .02 RPM | 1 .15 RPM |
| SRP051959_liver | 0 .04 RPM | 0 .95 RPM |
| SRP051959_lung | 0 .03 RPM | 17 .50 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 7 .28 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 7 .23 RPM |
| SRP051959_spleen | 0 .04 RPM | 12 .02 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3357 |
| Pan troglodytes | retro_ptro_2131 |
| Gorilla gorilla | retro_ggor_2276 |
| Macaca mulatta | retro_mmul_2095 |