RetrogeneDB ID: | retro_cjac_4084 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | X:68876381..68876591(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP5 | ||
| Ensembl ID: | ENSCJAG00000000444 | ||
| Aliases: | None | ||
| Description: | fatty acid binding protein 5 (psoriasis-associated) [Source:HGNC Symbol;Acc:3560] |
| Percent Identity: | 59.15 % |
| Parental protein coverage: | 52.99 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | QFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVDCVINNVTCTRIYEK |
| QFSC...EK..ETT...RKTQ....FT..ALVQHQE..GKEST..R..KDG.L...C...NVTCT.IY.K | |
| Retrocopy | QFSCKPEEKSKETTDYSRKTQAAYKFTNDALVQHQERGGKESTM-RNVKDGILITECAMYNVTCT*IYKK |
| Parental | V |
| V | |
| Retrocopy | V |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .16 RPM | 4 .68 RPM |
| SRP051959_heart | 0 .07 RPM | 17 .70 RPM |
| SRP051959_kidney | 0 .18 RPM | 1 .15 RPM |
| SRP051959_liver | 0 .06 RPM | 0 .95 RPM |
| SRP051959_lung | 0 .26 RPM | 17 .50 RPM |
| SRP051959_lymph_node | 0 .23 RPM | 7 .28 RPM |
| SRP051959_skeletal_muscle | 0 .11 RPM | 7 .23 RPM |
| SRP051959_spleen | 0 .21 RPM | 12 .02 RPM |