RetrogeneDB ID: | retro_cpor_948 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_36:11221509..11221741(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP5 | ||
| Ensembl ID: | ENSCPOG00000025732 | ||
| Aliases: | None | ||
| Description: | fatty acid-binding protein, epidermal [Source:RefSeq peptide;Acc:NP_001166563] |
| Percent Identity: | 73.17 % |
| Parental protein coverage: | 59.26 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | TESTLKTTQF-SCNLGEKFEETTADGRKTQT-VCNFTDGALVQHQEWDGKESTITRKLQDGKLVVVCVMN |
| .ESTL.TTQ..S.NLGEKFEET.ADGRK.QT.VC.F..G.LVQHQ.WDGKESTITRKLQ.GKLVV.CVMN | |
| Retrocopy | SESTLQTTQL<SRNLGEKFEETIADGRKPQT<VCTFIGGVLVQHQKWDGKESTITRKLQNGKLVVDCVMN |
| Parental | NVTCTRVYEKVE |
| .V......EKVE | |
| Retrocopy | IV--LNSHEKVE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 7 .71 RPM |
| SRP017611_kidney | 0 .00 RPM | 3 .98 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .09 RPM |
| SRP040447_lung | 0 .00 RPM | 156 .90 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 39 .25 RPM |