RetrogeneDB ID: | retro_cpor_373 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_136:290136..290488(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | METTL5 | ||
Ensembl ID: | ENSCPOG00000003343 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 51.22 % |
Parental protein coverage: | 58.94 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | EIFNRNVEEFELTNVDMVQCDVCSLSNRMAKSFDTVIMNPPFGTKNN-KGIDMTFLKTALEMARTAVYSL |
.I.....EEFELTNV.M.QC..CSL..R..K.FDTVI...PFGTK.N.KG..M..L...L.MAR.....L | |
Retrocopy | KILSKEEEEFELTNVGMIQCTICSLATRIFK*FDTVIIKLPFGTKTN>KGTGMASLENTLKMARI----L |
Parental | HKSSTREHVQKKAAEWKIKIDIIAELRYDLPALYNFHKKKSVDIEVDLIRFSF |
.K...R...Q.KA...K.KI.I..E....L.A...F.KKK.VD.EVDLI.FSF | |
Retrocopy | TKFLRRVQIQNKATK*KVKIYICTEI*C-LSASHKFYKKKLVDTEVDLI*FSF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 9 .55 RPM |
SRP017611_kidney | 0 .00 RPM | 9 .53 RPM |
SRP017611_liver | 0 .00 RPM | 10 .23 RPM |
SRP040447_lung | 0 .00 RPM | 10 .24 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 14 .92 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000003343 | 1 retrocopy |
retro_cpor_373 ,
|
Dasypus novemcinctus | ENSDNOG00000013460 | 2 retrocopies | |
Homo sapiens | ENSG00000138382 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000022484 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000018044 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000023054 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005018 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000010405 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012916 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000012621 | 3 retrocopies |