RetrogeneDB ID: | retro_dnov_2593 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_8878:106470..106838(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS25 | ||
| Ensembl ID: | ENSDNOG00000007880 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S25 [Source:HGNC Symbol;Acc:10413] |
| Percent Identity: | 71.32 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 4 |
| Parental | MPPKDDKKKKDAGKSAKKDKDPVNKSGGKAK-KKKWSKGKVRDKLNNLVLFDKAT-YDKLCKEVPNYKLI |
| M.PKD..K..DAGK.A.KDKDPVNKSGGKAK.KK.WS.GKVRDK..N.VLFDKA....K.C..V.NY.LI | |
| Retrocopy | MLPKDNEKRTDAGK*ARKDKDPVNKSGGKAK<KK-WSSGKVRDKRSNAVLFDKAA<LEKRCEDVSNYNLI |
| Parental | TPAVVSERLKIRGSLARAAL-QELLSKGLIKLVSKHRAQVIYTRNT-KGGDAPAAGEDA |
| TP...SERLK.RGSLARAAL.Q.LLSK.L.K.VSK.RA.VI.TRNT.KG.DAPA.GEDA | |
| Retrocopy | TPVMASERLKNRGSLARAAL<QGLLSKRLLKPVSKDRAPVIFTRNT<KGRDAPATGEDA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 569 .60 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 237 .82 RPM |
| SRP012922_heart | 0 .00 RPM | 366 .61 RPM |
| SRP012922_kidney | 0 .00 RPM | 677 .10 RPM |
| SRP012922_liver | 0 .00 RPM | 368 .59 RPM |
| SRP012922_lung | 0 .00 RPM | 814 .17 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 474 .60 RPM |
| SRP012922_spleen | 0 .11 RPM | 838 .08 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000027772 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013691 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007880 | 7 retrocopies |
retro_dnov_1092, retro_dnov_1566, retro_dnov_2219, retro_dnov_2593 , retro_dnov_346, retro_dnov_877, retro_dnov_973,
|
| Equus caballus | ENSECAG00000020978 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000014630 | 6 retrocopies | |
| Homo sapiens | ENSG00000118181 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025540 | 7 retrocopies | |
| Mus musculus | ENSMUSG00000009927 | 15 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017256 | 11 retrocopies | |
| Otolemur garnettii | ENSOGAG00000007265 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025915 | 6 retrocopies | |
| Pan troglodytes | ENSPTRG00000004361 | 10 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000012492 | 12 retrocopies | |
| Rattus norvegicus | ENSRNOG00000027503 | 5 retrocopies | |
| Sorex araneus | ENSSARG00000002284 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000010244 | 16 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005422 | 15 retrocopies |