RetrogeneDB ID: | retro_dnov_404 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_4437:119661..120054(+) | ||
Located in intron of: | ENSDNOG00000014527 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPL35 | ||
Ensembl ID: | ENSDNOG00000008329 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein L35 [Source:HGNC Symbol;Acc:14489] |
Percent Identity: | 77.1 % |
Parental protein coverage: | 68.98 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | APRLT--TSLGNLACGHTATIFNRVVPLLPNVLKLPVRTLTYCSTRKGKRKTVKAVIYRFLRLHSGLWLR |
.PRL....S.GNLAC...ATIFNRV.PLLP.VLKLPVRT....STR.GKRK.VK.VIYRFL.LHSGLWLR | |
Retrocopy | SPRLPDIASVGNLACRYAATIFNRVDPLLPHVLKLPVRTVAHYSTREGKRKVVKVVIYRFLLLHSGLWLR |
Parental | RKAGYKKKLWKKKPARKRRLREFVFCNKTQSKLLDKMTTSFWKRRNWYADDPYQKYHDRTN |
RKAGYKKKLW.KK.ARKRRLRE..FCNKTQ.KLLDKM..SFWKRRNWYADDPYQ.Y.D..N | |
Retrocopy | RKAGYKKKLWEKKLARKRRLRELAFCNKTQNKLLDKMIKSFWKRRNWYADDPYQRYRDGPN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 18 .47 RPM |
SRP012922_cerebellum | 0 .00 RPM | 11 .68 RPM |
SRP012922_heart | 0 .00 RPM | 16 .01 RPM |
SRP012922_kidney | 0 .27 RPM | 22 .18 RPM |
SRP012922_liver | 0 .00 RPM | 15 .79 RPM |
SRP012922_lung | 0 .00 RPM | 12 .68 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 18 .35 RPM |
SRP012922_spleen | 0 .00 RPM | 11 .56 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000019467 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000008329 | 1 retrocopy |
retro_dnov_404 ,
|
Homo sapiens | ENSG00000132313 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000026769 | 3 retrocopies | |
Macropus eugenii | ENSMEUG00000004773 | 1 retrocopy | |
Mus musculus | ENSMUSG00000052962 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002756 | 4 retrocopies | |
Otolemur garnettii | ENSOGAG00000004048 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012214 | 5 retrocopies | |
Pan troglodytes | ENSPTRG00000012152 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000008546 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015366 | 10 retrocopies | |
Tarsius syrichta | ENSTSYG00000007713 | 2 retrocopies |