RetrogeneDB ID: | retro_rnor_1399 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 18:51378028..51378375(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Mrpl35 | ||
| Ensembl ID: | ENSRNOG00000008546 | ||
| Aliases: | None | ||
| Description: | 39S ribosomal protein L35, mitochondrial [Source:RefSeq peptide;Acc:NP_001100066] |
| Percent Identity: | 53.39 % |
| Parental protein coverage: | 61.7 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | HLAYGHTASVLNRVATLVPSVLKPPVRALTYCSARKGKRKTVKSVVHRFLRLH-SGLWLRRKAGYKKKLW |
| HLA.GH.A.V..RV.TLVPSVLKPPVR.LT.....K......KS...RFL..H.SG.WLRRK.GY.KK.. | |
| Retrocopy | HLASGHSATVPDRVTTLVPSVLKPPVRTLTSFNTWKARERQ-KSGLLRFL*FH<SGFWLRRKTGYRKKIM |
| Parental | KKSTARKKRLREFV-FCNKTQSKLLDKMTTSFWKRRNWYTGDPYQMYH |
| .K....K..L......C.KTQSKL..KM...F..R.N....DPYQMYH | |
| Retrocopy | EKVNCKKEALEGICRVCKKTQSKLREKMMICFRNRYNQWA*DPYQMYH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 19 .20 RPM |
| SRP017611_kidney | 0 .00 RPM | 23 .24 RPM |
| SRP017611_liver | 0 .00 RPM | 12 .24 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Mus musculus | retro_mmus_1777 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000019467 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008329 | 1 retrocopy | |
| Homo sapiens | ENSG00000132313 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000026769 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000004773 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000052962 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002756 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004048 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012214 | 5 retrocopies | |
| Pan troglodytes | ENSPTRG00000012152 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008546 | 1 retrocopy |
retro_rnor_1399 ,
|
| Tupaia belangeri | ENSTBEG00000015366 | 10 retrocopies | |
| Tarsius syrichta | ENSTSYG00000007713 | 2 retrocopies |