RetrogeneDB ID: | retro_mmus_1777 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 18:57116729..57117103(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Mrpl35 | ||
Ensembl ID: | ENSMUSG00000052962 | ||
Aliases: | Mrpl35, 1110066C01Rik | ||
Description: | mitochondrial ribosomal protein L35 [Source:MGI Symbol;Acc:MGI:1913473] |
Percent Identity: | 64.34 % |
Parental protein coverage: | 68.09 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | VTSVGHLAYGHTTTVLNRVATLVPSVLKPPVRALTYCSTRK-GKRKTVKSVVHRFLRLHSGLWLRRKAGY |
.....H....H...VLNRV..LVPSVL.PPVR.LT...TRK.GKRKTV..VV..FL..H.G.WLRR.AG. | |
Retrocopy | LSNTWHMGIVHQS-VLNRV--LVPSVLEPPVRTLTS*NTRK<GKRKTVRVVVKCFL*FHPGFWLRRNAG* |
Parental | KKKLWKKSTARKKRLREFVFCSKTQSKLLDKMTTSFWKRRNWYAGDPYQMYHDRTNLRV |
KKK.WKKST.RKK.LREFV.C.KTQSKL.DKM..SFWK..NW..GDPYQM.HD.T.L.V | |
Retrocopy | KKKIWKKSTVRKKLLREFVSCNKTQSKLPDKMMMSFWKSCNWCPGDPYQMHHDCTSLTV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 23 .50 RPM |
SRP007412_cerebellum | 0 .00 RPM | 17 .93 RPM |
SRP007412_heart | 0 .00 RPM | 22 .54 RPM |
SRP007412_kidney | 0 .00 RPM | 19 .31 RPM |
SRP007412_liver | 0 .00 RPM | 15 .29 RPM |
SRP007412_testis | 0 .00 RPM | 24 .88 RPM |
Species | RetrogeneDB ID |
---|---|
Rattus norvegicus | retro_rnor_1399 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000019467 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000008329 | 1 retrocopy | |
Homo sapiens | ENSG00000132313 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000026769 | 3 retrocopies | |
Macropus eugenii | ENSMEUG00000004773 | 1 retrocopy | |
Mus musculus | ENSMUSG00000052962 | 1 retrocopy |
retro_mmus_1777 ,
|
Nomascus leucogenys | ENSNLEG00000002756 | 4 retrocopies | |
Otolemur garnettii | ENSOGAG00000004048 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012214 | 5 retrocopies | |
Pan troglodytes | ENSPTRG00000012152 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000008546 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015366 | 10 retrocopies | |
Tarsius syrichta | ENSTSYG00000007713 | 2 retrocopies |