RetrogeneDB ID: | retro_dnov_651 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_728:290491..290754(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CMC1 | ||
Ensembl ID: | ENSDNOG00000018923 | ||
Aliases: | None | ||
Description: | COX assembly mitochondrial protein 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:28783] |
Percent Identity: | 79.12 % |
Parental protein coverage: | 55. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | RPLPSPP-CPGAAERLSLAPPAEMALDPAEQ-HLRHVEKDVLIPK-IMREKARERCSEQVQDFTKCCKDS |
.PL..PP.CPGAAE.L.L.PP.EMAL.P.EQ.HLR.VEKDVLIPK.I..EK.RERCSEQ.QDFTK.CKDS | |
Retrocopy | KPLTPPP<CPGAAEQLPLSPPTEMALNPTEQ>HLRNVEKDVLIPK<IKSEKVRERCSEQGQDFTKYCKDS |
Parental | GLLMVVKCRKENSALKECLTA |
GLL.VVKCRKENSALKECLTA | |
Retrocopy | GLLTVVKCRKENSALKECLTA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 21 .78 RPM |
SRP012922_cerebellum | 0 .00 RPM | 11 .41 RPM |
SRP012922_heart | 0 .00 RPM | 8 .12 RPM |
SRP012922_kidney | 0 .00 RPM | 15 .61 RPM |
SRP012922_liver | 0 .00 RPM | 7 .59 RPM |
SRP012922_lung | 0 .00 RPM | 10 .08 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 7 .27 RPM |
SRP012922_spleen | 0 .00 RPM | 8 .47 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000004272 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000018923 | 2 retrocopies |
retro_dnov_111, retro_dnov_651 ,
|
Homo sapiens | ENSG00000187118 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000012406 | 4 retrocopies | |
Microcebus murinus | ENSMICG00000011702 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000000044 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004066 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000012793 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000009474 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014054 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000014706 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000010149 | 1 retrocopy | |
Sorex araneus | ENSSARG00000001629 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000002573 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000011371 | 2 retrocopies |