RetrogeneDB ID: | retro_ggor_2245 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 5:35033857..35034124(-) | ||
Located in intron of: | ENSGGOG00000008872 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CMC1 | ||
Ensembl ID: | ENSGGOG00000012406 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 73.03 % |
Parental protein coverage: | 79.46 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | VNSSTKLSSGANQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLT |
.....K......QHLRHVEK.V.IPKIMREKA..RCSEQ.QDFTKCCKNSG.L.V.KC.KENS.LK..LT | |
Retrocopy | IKNNGKTLQVLKQHLRHVEKVVWIPKIMREKARMRCSEQLQDFTKCCKNSGTLTVGKCWKENSLLKGRLT |
Parental | AYYNDPAFYEECKMEYLKE |
A.YNDPAFYEECKMEYLKE | |
Retrocopy | AHYNDPAFYEECKMEYLKE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .59 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .34 RPM |
SRP007412_heart | 0 .00 RPM | 2 .66 RPM |
SRP007412_kidney | 0 .25 RPM | 7 .97 RPM |
SRP007412_liver | 0 .00 RPM | 7 .36 RPM |
SRP007412_testis | 0 .00 RPM | 7 .67 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1764 |
Pan troglodytes | retro_ptro_1207 |
Pongo abelii | retro_pabe_1533 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000004272 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000018923 | 2 retrocopies | |
Homo sapiens | ENSG00000187118 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000012406 | 4 retrocopies | |
Microcebus murinus | ENSMICG00000011702 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000000044 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004066 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000012793 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000009474 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014054 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000014706 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000010149 | 1 retrocopy | |
Sorex araneus | ENSSARG00000001629 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000002573 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000011371 | 2 retrocopies |