RetrogeneDB ID: | retro_rnor_914 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 13:49816705..49816950(+) | ||
Located in intron of: | ENSRNOG00000003979 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Cmc1 | ||
Ensembl ID: | ENSRNOG00000010149 | ||
Aliases: | Cmc1, RGD1305283 | ||
Description: | COX assembly mitochondrial protein homolog isoform 1 [Source:RefSeq peptide;Acc:NP_001186154] |
Percent Identity: | 67.06 % |
Parental protein coverage: | 77.36 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | PAEQHLRHVEKDVLIPKIMREKARERCSEQVEDFTRCCKDSGILMVLKCRKENSALKDCLTAY-YNDPAF |
PA.QHLR.V.KD.L..K.MREK.RERCS.Q.EDFT...KD..IL.V.KC.KEN..LK.CLTAY..NDPAF | |
Retrocopy | PAGQHLRQVVKDFLTLK-MREKDRERCSRQGEDFTKYYKDAKILLV-KCQKEN*SLKECLTAY<QNDPAF |
Parental | YE--ECKLEYLKERE |
YE..E.KL.YLKE.E | |
Retrocopy | YERWEYKLKYLKEKE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 1 .58 RPM |
SRP017611_kidney | 0 .00 RPM | 7 .89 RPM |
SRP017611_liver | 0 .00 RPM | 7 .26 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000004272 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000018923 | 2 retrocopies | |
Homo sapiens | ENSG00000187118 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000012406 | 4 retrocopies | |
Microcebus murinus | ENSMICG00000011702 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000000044 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004066 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000012793 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000009474 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014054 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000014706 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000010149 | 1 retrocopy |
retro_rnor_914 ,
|
Sorex araneus | ENSSARG00000001629 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000002573 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000011371 | 2 retrocopies |