RetrogeneDB ID: | retro_fcat_1052 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | B4:90540178..90540598(-) | ||
Located in intron of: | ENSFCAG00000023896 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SUB1 | ||
Ensembl ID: | ENSFCAG00000006012 | ||
Aliases: | None | ||
Description: | SUB1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:19985] |
Percent Identity: | 85.21 % |
Parental protein coverage: | 97.22 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | SCKRASRGLFGCKSGAM-PKSKELVSSSSSGSDSDSEVDKKLKRKKQVTPEKPVKKQKTGETSRALSSSK |
.CK..SRGLF.CKSGA..PKSKELVSSSSSGSDS...VDKKLKRK.QVTPEKPVKKQKTGETSRALSSSK | |
Retrocopy | TCKQVSRGLFSCKSGAS<PKSKELVSSSSSGSDSECQVDKKLKRKRQVTPEKPVKKQKTGETSRALSSSK |
Parental | QSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQ-WSQLKEQISDIDD |
.S.S.RDDNMFQ.GKMRYVSVRD.K.KVLIDIREYWMD.EGE.KPGRKGISLNP.Q.WSQLKEQISD.DD | |
Retrocopy | KSRSHRDDNMFQTGKMRYVSVRDYKRKVLIDIREYWMDQEGEIKPGRKGISLNPKQ>WSQLKEQISDTDD |
Parental | AV |
AV | |
Retrocopy | AV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .11 RPM | 100 .43 RPM |
SRP017611_kidney | 0 .00 RPM | 61 .63 RPM |
SRP017611_liver | 0 .00 RPM | 27 .70 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006238 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000018879 | 5 retrocopies | |
Felis catus | ENSFCAG00000006012 | 2 retrocopies |
retro_fcat_1052 , retro_fcat_1313,
|
Gorilla gorilla | ENSGGOG00000027033 | 3 retrocopies | |
Loxodonta africana | ENSLAFG00000011006 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000007770 | 4 retrocopies | |
Microcebus murinus | ENSMICG00000014535 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000013685 | 6 retrocopies | |
Monodelphis domestica | ENSMODG00000020410 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000015185 | 2 retrocopies | |
Mus musculus | ENSMUSG00000022205 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006262 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000009012 | 6 retrocopies | |
Ochotona princeps | ENSOPRG00000012887 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000015379 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000050563 | 12 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000014986 | 1 retrocopy |