RetrogeneDB ID: | retro_ggor_1063 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 14:55562174..55562402(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSGGOG00000023112 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUB1 | ||
| Ensembl ID: | ENSGGOG00000027033 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.95 % |
| Parental protein coverage: | 57.6 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MPKSKELVSSSSSGSDSDSEVDKKLKEKGCNLPEIPFFKKKKMRSSRILVSS----SFSSRPQFLLQIGK |
| MPKSKEL.SSSSSGS.SDS.VDKKLK.K....PE.P..K.K.....R.L.SS....S.S.......Q..K | |
| Retrocopy | MPKSKELISSSSSGSGSDSDVDKKLKRKKQVAPERPVKKQKTGET*RALSSSKENSSSSTVDNMMFQVRK |
| Parental | MRYVSV |
| MRY..V | |
| Retrocopy | MRYINV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 21 .10 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 11 .31 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .91 RPM |
| SRP007412_kidney | 0 .00 RPM | 30 .54 RPM |
| SRP007412_liver | 0 .00 RPM | 19 .94 RPM |
| SRP007412_testis | 0 .21 RPM | 19 .58 RPM |