RetrogeneDB ID: | retro_fcat_512 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | B1:14010553..14010759(+) | ||
Located in intron of: | ENSFCAG00000027833 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMEM167A | ||
Ensembl ID: | ENSFCAG00000012375 | ||
Aliases: | None | ||
Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
Percent Identity: | 84.29 % |
Parental protein coverage: | 97.18 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | IFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCC-IVMAFSILFIQ |
.F.FQSLLTVILLL.CTCAYI.SLAP.LLDRNKTGLLGIFWKCARIGERKSPYVAVCC...MAF...FIQ | |
Retrocopy | VFGFQSLLTVILLLVCTCAYILSLAPGLLDRNKTGLLGIFWKCARIGERKSPYVAVCC<YTMAFGVFFIQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .11 RPM | 11 .94 RPM |
SRP017611_kidney | 0 .00 RPM | 9 .17 RPM |
SRP017611_liver | 0 .00 RPM | 8 .29 RPM |