RetrogeneDB ID: | retro_dnov_924 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_122306:3444..3653(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMEM167A | ||
Ensembl ID: | ENSDNOG00000003073 | ||
Aliases: | None | ||
Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
Percent Identity: | 65.75 % |
Parental protein coverage: | 98.59 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | AIFNFQSL-LTVILLLICTCAYIRSLAPSLLDRNKTGLLGIF-WKCARIGERKSPYVAVCCIVMAF-SIL |
A.FNFQ.L.LT.ILLL.CT.A..RS.APSLLDRNK.GL.GIF..KCARIGE.K.P.V..CC....F...L | |
Retrocopy | AVFNFQRL>LTLILLLLCTWAHTRSSAPSLLDRNKNGLWGIF<SKCARIGE*KGPHVVACCTATTF<CVL |
Parental | FVQ |
FVQ | |
Retrocopy | FVQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .39 RPM | 2 .92 RPM |
SRP012922_cerebellum | 0 .00 RPM | 0 .41 RPM |
SRP012922_heart | 0 .00 RPM | 0 .70 RPM |
SRP012922_kidney | 0 .00 RPM | 1 .37 RPM |
SRP012922_liver | 0 .00 RPM | 0 .77 RPM |
SRP012922_lung | 0 .00 RPM | 1 .53 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 0 .87 RPM |
SRP012922_spleen | 0 .00 RPM | 1 .60 RPM |