RetrogeneDB ID: | retro_cfam_904 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 2:54922130..54922328(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM167A | ||
| Ensembl ID: | ENSCAFG00000029436 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
Retrocopy-Parental alignment summary:
>retro_cfam_904
TTTCAGAATCTGTTGACTATAATCTTGCTGCTTATATGTATCTGGGTTTATATCTAATCCTTGACGCTCAGCCTCCTGGA
CAGAAATAAGACTGGATTGTTTGATATATTTCAGAAGTGTGCCAAAATTGGTGAACAGAAGCATTTTTATGTGGCAGTAT
GCTGTGTAGTGATAGCCTTCGGCATCCTCTTCACACAG
ORF - retro_cfam_904 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 71.21 % |
| Parental protein coverage: | 91.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | FQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILFMQ |
| FQ.LLT.ILLLIC...YI.SL..SLLDRNKTGL..IF.KCA.IGE.K..YVAVCC.V.AF.ILF.Q | |
| Retrocopy | FQNLLTIILLLICIWVYI*SLTLSLLDRNKTGLFDIFQKCAKIGEQKHFYVAVCCVVIAFGILFTQ |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 10 .63 RPM |
| SRP017611_brain | 0 .00 RPM | 9 .53 RPM |
| SRP017611_kidney | 0 .00 RPM | 26 .75 RPM |
| SRP017611_liver | 0 .00 RPM | 4 .79 RPM |
Canis familiaris was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_cfam_904 retrocopy.
Canis familiaris was not studied using FANTOM5 data.
retro_cfam_904 was not experimentally validated.