RetrogeneDB ID: | retro_tsyr_1844 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_61788:10948..11163(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM167A | ||
| Ensembl ID: | ENSTSYG00000010018 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
| Percent Identity: | 80.82 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MSAIFNFQSLLTVILLLICTCAYIRSLAPSVLDRNKTGLL-GIFWKCARIGERKSPYVAVCCVVMAFSVL |
| .SAIFNF.SLLTVIL.L.CTCA.I.SLAPS.LDRN.TGLL.GIFWKCARIG..KSPYV.VCCVVMAF..L | |
| Retrocopy | ISAIFNF*SLLTVILMLLCTCANIHSLAPSLLDRNTTGLL<GIFWKCARIG*QKSPYVGVCCVVMAFGIL |
| Parental | FIQ |
| FIQ | |
| Retrocopy | FIQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |