RetrogeneDB ID: | retro_dnov_1756 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_28891:14240..14453(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM167A | ||
| Ensembl ID: | ENSDNOG00000003073 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
| Percent Identity: | 91.55 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | SAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILFV |
| SAIFNFQSLLT.ILLLICTCAYI.SLA.SLLDRNKTGLLGIFWKCARIGE.K.PYVAVCCIVMAFSILF. | |
| Retrocopy | SAIFNFQSLLTAILLLICTCAYIPSLAHSLLDRNKTGLLGIFWKCARIGE*KRPYVAVCCIVMAFSILFA |
| Parental | Q |
| Q | |
| Retrocopy | Q |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 3 .11 RPM | 2 .92 RPM |
| SRP012922_cerebellum | 0 .69 RPM | 0 .41 RPM |
| SRP012922_heart | 1 .39 RPM | 0 .70 RPM |
| SRP012922_kidney | 2 .46 RPM | 1 .37 RPM |
| SRP012922_liver | 2 .94 RPM | 0 .77 RPM |
| SRP012922_lung | 1 .68 RPM | 1 .53 RPM |
| SRP012922_quadricep_muscle | 0 .69 RPM | 0 .87 RPM |
| SRP012922_spleen | 1 .49 RPM | 1 .60 RPM |