RetrogeneDB ID: | retro_mmus_2898 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 7:13848727..13848943(+) | ||
Located in intron of: | ENSMUSG00000081982 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Tmem167 | ||
Ensembl ID: | ENSMUSG00000012422 | ||
Aliases: | None | ||
Description: | transmembrane protein 167 [Source:MGI Symbol;Acc:MGI:1913324] |
Percent Identity: | 80.56 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MSAIFNFQSLLTVILLLICTCAYIRSLAPSILDRNKTGLLGIFWKCARIGERKSPYVAICCIVMAFSILF |
M.AI.NFQSLLTVILLLI..CAYI.SLA.SILDRNKTGLL.I.WKC..IGE.KSPYVAI..IV.AFSILF | |
Retrocopy | MPAIINFQSLLTVILLLIFMCAYI*SLAHSILDRNKTGLLIILWKCVQIGECKSPYVAIWFIVIAFSILF |
Parental | IQ |
IQ | |
Retrocopy | IQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 42 .96 RPM |
SRP007412_cerebellum | 0 .00 RPM | 32 .26 RPM |
SRP007412_heart | 0 .00 RPM | 11 .89 RPM |
SRP007412_kidney | 0 .00 RPM | 21 .54 RPM |
SRP007412_liver | 0 .00 RPM | 30 .39 RPM |
SRP007412_testis | 0 .00 RPM | 8 .46 RPM |