RetrogeneDB ID: | retro_ggor_1587 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 22:1103550..1103795(+) | ||
Located in intron of: | ENSGGOG00000007790 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAM32A | ||
Ensembl ID: | ENSGGOG00000022418 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 83.13 % |
Parental protein coverage: | 73.21 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQE |
..AYEQVQKG.LKLKGVAEL.VTKRKKK.KDKDKAKL.E.MG..KKNEEEK..GLDK.TPA.AAFEKMQE | |
Retrocopy | VDAYEQVQKGLLKLKGVAELRVTKRKKKNKDKDKAKLPESMGMNKKNEEEKQHGLDKWTPARAAFEKMQE |
Parental | KRQ-MERILKKAS |
KRQ.MERILKKAS | |
Retrocopy | KRQ<MERILKKAS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 67 .47 RPM |
SRP007412_cerebellum | 0 .00 RPM | 46 .81 RPM |
SRP007412_heart | 0 .03 RPM | 21 .83 RPM |
SRP007412_kidney | 0 .00 RPM | 61 .66 RPM |
SRP007412_liver | 0 .00 RPM | 43 .13 RPM |
SRP007412_testis | 0 .00 RPM | 44 .24 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000046846 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000014097 | 4 retrocopies | |
Homo sapiens | ENSG00000105058 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000022418 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000009394 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000013721 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000000585 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000014904 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000016048 | 1 retrocopy | |
Mus musculus | ENSMUSG00000003039 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005441 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000027763 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000010641 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000039528 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000013855 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000009106 | 1 retrocopy |