RetrogeneDB ID: | retro_ggor_872 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 12:48926458..48926727(-) | ||
Located in intron of: | ENSGGOG00000012313 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAM32A | ||
Ensembl ID: | ENSGGOG00000022418 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70.33 % |
Parental protein coverage: | 80.36 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | AYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFE-KMQEK |
A..QVQKGPL.LKG.AEL.V.K.KKKKKDK.KA..L.AM..SKKN..EK...LDK.TPAQ.A.E.KMQEK | |
Retrocopy | ASDQVQKGPL*LKGIAELSVIKQKKKKKDKGKANFLKAMAMSKKNKGEKQHSLDKWTPAQMALE<KMQEK |
Parental | RQMERILKKASKTHKQRVEDF |
.QM.RILKKAS...KQRVEDF | |
Retrocopy | CQMGRILKKASEIYKQRVEDF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 67 .47 RPM |
SRP007412_cerebellum | 0 .04 RPM | 46 .81 RPM |
SRP007412_heart | 0 .00 RPM | 21 .83 RPM |
SRP007412_kidney | 0 .00 RPM | 61 .66 RPM |
SRP007412_liver | 0 .03 RPM | 43 .13 RPM |
SRP007412_testis | 0 .00 RPM | 44 .24 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1116 |
Pan troglodytes | retro_ptro_684 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000046846 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000014097 | 4 retrocopies | |
Homo sapiens | ENSG00000105058 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000022418 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000009394 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000013721 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000000585 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000014904 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000016048 | 1 retrocopy | |
Mus musculus | ENSMUSG00000003039 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005441 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000027763 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000010641 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000039528 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000013855 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000009106 | 1 retrocopy |