RetrogeneDB ID: | retro_mmul_1850 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 4:119537499..119537747(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPL42 | ||
| Ensembl ID: | ENSMMUG00000016805 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.41 % |
| Parental protein coverage: | 64.12 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | VCYHPSVDIPYEHTKPVPR-PDPVHNNEETHDQVLKTRLEEKVEHLEEGP-MIEKLSKMFFTTKHRWYPH |
| .CYHPSVDIPYEHTK..P...DPVHNN.ETHDQVL.TRLEE..EHLE.GP..I..LSKMF.TTKH.WYPH | |
| Retrocopy | LCYHPSVDIPYEHTKLIPL>TDPVHNN*ETHDQVLRTRLEE-YEHLEQGP<QIDQLSKMFVTTKHCWYPH |
| Parental | GQYHRRRTN-LNPPKDR |
| G.YHR...N..NPPK.R | |
| Retrocopy | G*YHRVIKN<RNPPKGR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 11 .99 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .68 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .01 RPM |
| SRP007412_heart | 0 .00 RPM | 15 .02 RPM |
| SRP007412_kidney | 0 .00 RPM | 16 .31 RPM |
| SRP007412_liver | 0 .00 RPM | 8 .31 RPM |
| SRP007412_testis | 0 .00 RPM | 52 .58 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3528 |
| Pan troglodytes | retro_ptro_2396 |
| Pongo abelii | retro_pabe_2914 |