RetrogeneDB ID: | retro_mmul_633 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 10:38352488..38352712(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.17369 | ||
Ensembl ID: | ENSMMUG00000005006 | ||
Aliases: | None | ||
Description: | 40S ribosomal protein S21 [Source:UniProtKB/TrEMBL;Acc:F7AM79] |
Percent Identity: | 67.11 % |
Parental protein coverage: | 90.36 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | VDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDD-SILRLARADG |
V.L....KCS.SN.II..K..ASIQ.NVAEVDKV..RFNGQFKTYA..GAI.RMG..DD.SIL.L..AD. | |
Retrocopy | VSLWTCMKCSTSNCIISIKHYASIQINVAEVDKVMSRFNGQFKTYALGGAI*RMGK*DD<SIL*LSNADD |
Parental | IVSKNF |
IVS.NF | |
Retrocopy | IVSNNF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 35 .30 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 149 .85 RPM |
SRP007412_cerebellum | 0 .06 RPM | 33 .06 RPM |
SRP007412_heart | 0 .00 RPM | 62 .30 RPM |
SRP007412_kidney | 0 .00 RPM | 49 .76 RPM |
SRP007412_liver | 0 .00 RPM | 228 .60 RPM |
SRP007412_testis | 0 .00 RPM | 37 .81 RPM |