RetrogeneDB ID: | retro_mmus_403 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 1:191407660..191407956(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Pabpn1 | ||
Ensembl ID: | ENSMUSG00000022194 | ||
Aliases: | None | ||
Description: | poly(A) binding protein, nuclear 1 [Source:MGI Symbol;Acc:MGI:1859158] |
Percent Identity: | 84. % |
Parental protein coverage: | 59.76 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | SEELEAIK-ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARSIYVGNVDYGAT |
SEELE.IK.A.V.E.EEEAEKLKELQ..VEKQ.NMSPPPGNAGPVIMSLEEKMEADA.SIYVGNV.YGAT | |
Retrocopy | SEELESIKQA*VWETEEEAEKLKELQSKVEKQANMSPPPGNAGPVIMSLEEKMEADACSIYVGNVNYGAT |
Parental | AEELEAH-FHGCGSVNRVTILCDKFSGHPK |
AEEL.AH...GCGSVN.VTILCDKFSGHP. | |
Retrocopy | AEELGAH<LNGCGSVNCVTILCDKFSGHPR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .02 RPM | 36 .89 RPM |
SRP007412_cerebellum | 0 .00 RPM | 36 .39 RPM |
SRP007412_heart | 0 .03 RPM | 9 .87 RPM |
SRP007412_kidney | 0 .00 RPM | 20 .33 RPM |
SRP007412_liver | 0 .00 RPM | 12 .07 RPM |
SRP007412_testis | 0 .18 RPM | 31 .70 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000006884 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000007960 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000002873 | 1 retrocopy | |
Homo sapiens | ENSG00000100836 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000022683 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000031227 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000014747 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000006775 | 1 retrocopy | |
Mus musculus | ENSMUSG00000022194 | 1 retrocopy |
retro_mmus_403 ,
|
Nomascus leucogenys | ENSNLEG00000015009 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000016174 | 4 retrocopies | |
Otolemur garnettii | ENSOGAG00000008710 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005663 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000006168 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000002023 | 1 retrocopy |