RetrogeneDB ID: | retro_sscr_475 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 15:130002327..130002567(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM6 | ||
Ensembl ID: | ENSSSCG00000009036 | ||
Aliases: | None | ||
Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17017] |
Percent Identity: | 78.75 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV |
MS..KQTPSDFLK.I.G.PVVVKLNSG.DY...L..LDGYMN.ALEQ.EEYVNG.LKNKYG.AFIRGNNV | |
Retrocopy | MSMKKQTPSDFLKKITGQPVVVKLNSGMDY*RTLVFLDGYMNVALEQMEEYVNGELKNKYGGAFIRGNNV |
Parental | LYISTQKRRM |
L.ISTQKR.M | |
Retrocopy | LCISTQKRSM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 2 .39 RPM |
SRP014902_testis | 0 .00 RPM | 23 .90 RPM |
SRP018288_heart | 0 .00 RPM | 15 .35 RPM |
SRP018288_kidney | 0 .00 RPM | 14 .87 RPM |
SRP018288_liver | 0 .00 RPM | 14 .23 RPM |
SRP018288_lung | 0 .00 RPM | 23 .93 RPM |
SRP018856_adipose | 0 .00 RPM | 16 .16 RPM |
SRP035408_brain | 0 .00 RPM | 13 .66 RPM |
SRP035408_liver | 0 .00 RPM | 24 .25 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000014060 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
Homo sapiens | ENSG00000164167 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000000895 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000009036 | 2 retrocopies |
retro_sscr_474, retro_sscr_475 ,
|
Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |