RetrogeneDB ID: | retro_cjac_1660 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 18:3738986..3739226(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2D4 | ||
Ensembl ID: | ENSCJAG00000007875 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2D 4 (putative) [Source:HGNC Symbol;Acc:21647] |
Percent Identity: | 75.31 % |
Parental protein coverage: | 54.73 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | FLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV |
FL..H.P..Y.FKPPKVAFT....HP..NSNGSIC.D.L.SQWSPALTVSKVLLSICSLLC.PN.DDPLV | |
Retrocopy | FLPDH-PLAYGFKPPKVAFTARFPHPSVNSNGSICHDSLWSQWSPALTVSKVLLSICSLLCTPNLDDPLV |
Parental | PEVAHTYKADR |
PE.AHTY.A.R | |
Retrocopy | PEIAHTYQAGR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 2 .13 RPM |
SRP051959_heart | 0 .04 RPM | 9 .98 RPM |
SRP051959_kidney | 0 .00 RPM | 9 .34 RPM |
SRP051959_liver | 0 .00 RPM | 6 .19 RPM |
SRP051959_lung | 0 .08 RPM | 5 .45 RPM |
SRP051959_lymph_node | 0 .00 RPM | 3 .68 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 25 .16 RPM |
SRP051959_spleen | 0 .00 RPM | 4 .50 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003997 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000007875 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000011559 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000015492 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000015818 | 9 retrocopies | |
Dipodomys ordii | ENSDORG00000006888 | 5 retrocopies | |
Homo sapiens | ENSG00000078967 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000003378 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000011919 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000002410 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000003364 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008900 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000029727 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000016722 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000003691 | 9 retrocopies | |
Tarsius syrichta | ENSTSYG00000000595 | 14 retrocopies |