RetrogeneDB ID: | retro_pabe_3573 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | Un:11644370..11644691(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2D4 | ||
Ensembl ID: | ENSPPYG00000029727 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2D 4 (putative) [Source:HGNC Symbol;Acc:21647] |
Percent Identity: | 85.05 % |
Parental protein coverage: | 62.57 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | NDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLL |
NDSP.QGGVFFLTIHFPTD..FKPPK.AFTTKIYHPNINSNGSIC.DIL.SQWSPALTVSK.LLSICSL. | |
Retrocopy | NDSPCQGGVFFLTIHFPTDCLFKPPKDAFTTKIYHPNINSNGSICFDILWSQWSPALTVSKDLLSICSLP |
Parental | CDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAI |
C.PN..DPLV.EIAHTYKADRE.YNRLAR.WT.KYA. | |
Retrocopy | CIPNLNDPLVLEIAHTYKADRENYNRLARQWTEKYAM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 23 .39 RPM |
SRP007412_cerebellum | 0 .00 RPM | 23 .96 RPM |
SRP007412_heart | 0 .00 RPM | 14 .12 RPM |
SRP007412_kidney | 0 .00 RPM | 18 .73 RPM |
SRP007412_liver | 0 .00 RPM | 13 .28 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_453 |
Homo sapiens | retro_hsap_452 |
Pan troglodytes | retro_ptro_341 |
Macaca mulatta | retro_mmul_531 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003997 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000007875 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000006888 | 5 retrocopies | |
Homo sapiens | ENSG00000078967 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000003378 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000011919 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000002410 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000003364 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008900 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000011602 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012987 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014967 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015844 | 6 retrocopies | |
Pongo abelii | ENSPPYG00000029727 | 1 retrocopy |
retro_pabe_3573 ,
|
Sus scrofa | ENSSSCG00000016722 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000003691 | 9 retrocopies | |
Tarsius syrichta | ENSTSYG00000000595 | 14 retrocopies |