RetrogeneDB ID: | retro_cjac_2085 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 22:8878387..8878780(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBXN2A | ||
Ensembl ID: | ENSCJAG00000007665 | ||
Aliases: | None | ||
Description: | UBX domain protein 2A [Source:HGNC Symbol;Acc:27265] |
Percent Identity: | 72.99 % |
Parental protein coverage: | 64.25 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 4 |
Parental | QPLGNNQQSNCEYFVDSLFEEAQKVGSKCVSSTEQKKQVDVNIK-LWKNGFTV-NDDFRSYSDGASQQFL |
QPLG.NQQ..CEY.V.SLF.EAQKVGSKC.S.TEQKKQVD.NIK.LW.NGFTV..DDFRSYS.GAS.QFL | |
Retrocopy | QPLGDNQQTKCEYLVNSLFYEAQKVGSKCLSHTEQKKQVDINIK>LWENGFTV<HDDFRSYSNGAS*QFL |
Parental | NSIKKGELP-SELQRIFDKEEVD-VKVEDKKNEVCMSTKPVFQPFSGQGHRLGRVSHIKDFIEKYQG |
NSIKKGELP..ELQ.IFDKEEVD..K....K....M..KPV.Q.FSGQ.H..GRVSHIKDF.EK.QG | |
Retrocopy | NSIKKGELP<LELQGIFDKEEVD>LKFKTRKIKYAM--KPVLQLFSGQAHQSGRVSHIKDFTEKHQG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .49 RPM | 6 .66 RPM |
SRP051959_heart | 0 .32 RPM | 8 .66 RPM |
SRP051959_kidney | 0 .18 RPM | 6 .32 RPM |
SRP051959_liver | 0 .06 RPM | 2 .23 RPM |
SRP051959_lung | 0 .62 RPM | 10 .36 RPM |
SRP051959_lymph_node | 0 .30 RPM | 9 .95 RPM |
SRP051959_skeletal_muscle | 0 .04 RPM | 15 .77 RPM |
SRP051959_spleen | 0 .53 RPM | 6 .85 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000001640 | 5 retrocopies | |
Callithrix jacchus | ENSCJAG00000007665 | 1 retrocopy |
retro_cjac_2085 ,
|
Equus caballus | ENSECAG00000020144 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000002623 | 1 retrocopy | |
Homo sapiens | ENSG00000173960 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002445 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000015640 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006487 | 1 retrocopy | |
Mus musculus | ENSMUSG00000020634 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000751 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000008783 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000000025 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000011502 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000011705 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000004950 | 2 retrocopies | |
Sorex araneus | ENSSARG00000010108 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000026283 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000012158 | 1 retrocopy |