RetrogeneDB ID: | retro_mmul_2068 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 6:20912292..20912691(-) | ||
Located in intron of: | ENSMMUG00000030195 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBXN2A | ||
Ensembl ID: | ENSMMUG00000006487 | ||
Aliases: | None | ||
Description: | UBX domain protein 2A [Source:HGNC Symbol;Acc:27265] |
Percent Identity: | 59.26 % |
Parental protein coverage: | 66.17 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | VDVNIKLWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKK-NEICLSTKPV |
V.V.IKL..N......DFR.YSD.AS..FL.SI.K......L...FDKE.V..KVEDKK.NE.CLS.KPV | |
Retrocopy | VNVSIKL*ENELSITNDFRHYSDVAS*KFLKSIIKEIYFLKLWRVFDKENVVAKVEDKK>NEVCLSMKPV |
Parental | FQPFSGQGHRLGSATPKI-VSKAKNIEVENKNNLSAVPLNNLEPITNIQIWLANGKRIVQKFNIS |
FQ.FSG..HRLG.AT..I...KAK..E.ENKN.L..VPL.NLEPI...QIWL.N.K.I.QK.NIS | |
Retrocopy | FQSFSG*SHRLGNATWEI<IFKAKSSEDENKNTLFVVPLSNLEPIITLQIWLTNWKGIIQKANIS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 1 .79 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .95 RPM |
SRP007412_cerebellum | 0 .00 RPM | 2 .97 RPM |
SRP007412_heart | 0 .00 RPM | 1 .88 RPM |
SRP007412_kidney | 0 .00 RPM | 1 .29 RPM |
SRP007412_liver | 0 .00 RPM | 0 .51 RPM |
SRP007412_testis | 0 .00 RPM | 2 .22 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000001640 | 5 retrocopies | |
Callithrix jacchus | ENSCJAG00000007665 | 1 retrocopy | |
Equus caballus | ENSECAG00000020144 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000002623 | 1 retrocopy | |
Homo sapiens | ENSG00000173960 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002445 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000015640 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006487 | 1 retrocopy |
retro_mmul_2068 ,
|
Macaca mulatta | ENSMMUG00000015994 | 1 retrocopy | |
Mus musculus | ENSMUSG00000020634 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000751 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000008783 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000000025 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000011502 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000011705 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000004950 | 2 retrocopies | |
Sorex araneus | ENSSARG00000010108 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000026283 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000012158 | 1 retrocopy |