RetrogeneDB ID: | retro_ggor_1463 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 19:9535030..9535459(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBXN2A | ||
| Ensembl ID: | ENSGGOG00000002445 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.33 % |
| Parental protein coverage: | 55.6 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQVDVNIKLWKN |
| MKDV.NL.SIK..WVCETG.DNQ.LG.NQ..NCE.FVDSLFEEAQKV.SKC.SP..QKKQVDVNIKLWKN | |
| Retrocopy | MKDVYNLESIKD-WVCETGPDNQRLGDNQ*TNCE*FVDSLFEEAQKVGSKCLSPT*QKKQVDVNIKLWKN |
| Parental | GFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKKNEICLSTKPVFQPFSGQGHRL |
| GFTVN..FRSYS.GASQQFLNSIKKGELPSELQGIFDKEEV.VKVEDKKNEIC.STKPVFQPFSGQGH.. | |
| Retrocopy | GFTVNNYFRSYSNGASQQFLNSIKKGELPSELQGIFDKEEVGVKVEDKKNEICMSTKPVFQPFSGQGHQV |
| Parental | GSAT |
| G... | |
| Retrocopy | GKVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .02 RPM |
| SRP007412_cerebellum | 0 .47 RPM | 4 .06 RPM |
| SRP007412_heart | 0 .03 RPM | 1 .25 RPM |
| SRP007412_kidney | 0 .12 RPM | 4 .46 RPM |
| SRP007412_liver | 0 .08 RPM | 1 .82 RPM |
| SRP007412_testis | 0 .10 RPM | 3 .73 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000001640 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007665 | 1 retrocopy | |
| Equus caballus | ENSECAG00000020144 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000002623 | 1 retrocopy | |
| Homo sapiens | ENSG00000173960 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002445 | 1 retrocopy |
retro_ggor_1463 ,
|
| Gorilla gorilla | ENSGGOG00000013539 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000015640 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006487 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020634 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000751 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000008783 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000025 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000011502 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000011705 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004950 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000010108 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000026283 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012158 | 1 retrocopy |