RetrogeneDB ID: | retro_fcat_984 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | B4:102364299..102364738(+) | ||
Located in intron of: | ENSFCAG00000027470 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RAB5A | ||
Ensembl ID: | ENSFCAG00000004455 | ||
Aliases: | None | ||
Description: | RAB5A, member RAS oncogene family [Source:HGNC Symbol;Acc:9783] |
Percent Identity: | 80.67 % |
Parental protein coverage: | 61.67 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | VCLDDTTVKFEIWDTAGQERYHSLAP-MYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIAL |
.CLDDTTV.F..WDTAGQE.YHSLAP.MYYR.AQAAIVV.DIT.E.S..RAKNW.KELQ.QA.P..VIAL | |
Retrocopy | LCLDDTTVEFDVWDTAGQECYHSLAP<MYYREAQAAIVVCDITDESS-GRAKNWAKELQTQANPSNVIAL |
Parental | SGNK-ADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGV |
SGN..A.LAN.RAVDFQEAQSY.DDNSLLFMETSAKTSMNVNEIFMA.AK.LPKNEPQ.PGANSARG..V | |
Retrocopy | SGNR<ANLANERAVDFQEAQSYEDDNSLLFMETSAKTSMNVNEIFMAVAKMLPKNEPQKPGANSARGKRV |
Parental | DLTEPTQPTR |
DLTEP.QP.R | |
Retrocopy | DLTEPMQPIR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .46 RPM | 33 .74 RPM |
SRP017611_kidney | 0 .00 RPM | 13 .50 RPM |
SRP017611_liver | 0 .00 RPM | 10 .21 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000954 | 1 retrocopy | |
Bos taurus | ENSBTAG00000046385 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000003731 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000005322 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000012429 | 1 retrocopy | |
Felis catus | ENSFCAG00000004455 | 2 retrocopies |
retro_fcat_1349, retro_fcat_984 ,
|
Homo sapiens | ENSG00000144566 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000015981 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000008321 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006992 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000014793 | 2 retrocopies | |
Mus musculus | ENSMUSG00000017831 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000003434 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000012200 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014074 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000014682 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000026229 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007642 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000001374 | 1 retrocopy |