RetrogeneDB ID: | retro_btau_300 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 1:71846274..71846568(-) | ||
| Located in intron of: | ENSBTAG00000048195 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BT.24043 | ||
| Ensembl ID: | ENSBTAG00000046385 | ||
| Aliases: | None | ||
| Description: | ras-related protein Rab-5A [Source:RefSeq peptide;Acc:NP_001069654] |
| Percent Identity: | 61.39 % |
| Parental protein coverage: | 62.73 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | NEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEI |
| NE.SF.R.KN.VK.LQR..SPN.VI.L.G...DL..K...DFQEAQS.A.D....F..TS..T.MNVN.I | |
| Retrocopy | NEGSFVRTKN*VKLLQREVSPNTVITLPGK*VDL-EKMG*DFQEAQSCANDK--VFTKTSSQTTMNVNKI |
| Parental | FMAIAKKLPKNEPQNPGANSTRGRGVDLTEP |
| F..IAKKLP.NE.QNPG.NS.R.R..DLTEP | |
| Retrocopy | FTVIAKKLPRNELQNPGPNSARARAADLTEP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 23 .29 RPM |
| ERP005899_muscle | 0 .00 RPM | 18 .79 RPM |
| SRP017611_brain | 0 .00 RPM | 51 .43 RPM |
| SRP017611_kidney | 0 .00 RPM | 29 .87 RPM |
| SRP017611_liver | 0 .00 RPM | 20 .92 RPM |
| SRP030211_testis | 0 .00 RPM | 33 .96 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000954 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000046385 | 1 retrocopy |
retro_btau_300 ,
|
| Callithrix jacchus | ENSCJAG00000003731 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000005322 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000012429 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004455 | 2 retrocopies | |
| Homo sapiens | ENSG00000144566 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015981 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000008321 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006992 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000014793 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000017831 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003434 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000012200 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014074 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000014682 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000026229 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007642 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001374 | 1 retrocopy |