RetrogeneDB ID: | retro_mdom_1445 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 5:89274332..89274566(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000028750 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 65.38 % |
Parental protein coverage: | 50.98 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 0 |
Parental | KMAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAIKARA |
KM.KSK.H.T.NQ..KWH..GI....S.RY.SLKGVDPKF.RN...AKK.N.KGLKKMQANNA.AIK... | |
Retrocopy | KMGKSKTHFTPNQL*KWHKDGIN*SGS*RYQSLKGVDPKFPRNV*IAKKQNTKGLKKMQANNASAIKVQT |
Parental | EAIKALST |
EA.KA.S. | |
Retrocopy | EAFKAKSS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |