RetrogeneDB ID: | retro_fcat_1774 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | F1:19905200..19905446(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000001762 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.07 % |
| Parental protein coverage: | 50.93 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAE |
| M.KSKNH.THNQ.RK.HRNG.KKP.S..YESL.G...KFL.N.RFA.KH.KK..KK.QAN.AK..SAR.E | |
| Retrocopy | MGKSKNHATHNQLRKRHRNGTKKPQSPKYESLRGRELKFLKNTRFAEKHSKKRPKKTQANDAKTTSARVE |
| Parental | AIKALVKPKEVK |
| A.KALVKP...K | |
| Retrocopy | AFKALVKPNSPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 68 .86 RPM |
| SRP017611_kidney | 0 .00 RPM | 325 .66 RPM |
| SRP017611_liver | 0 .00 RPM | 156 .99 RPM |