RetrogeneDB ID: | retro_mdom_1756 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 7:237006668..237006983(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RAP1B | ||
Ensembl ID: | ENSMODG00000007323 | ||
Aliases: | None | ||
Description: | RAP1B, member of RAS oncogene family [Source:HGNC Symbol;Acc:9857] |
Percent Identity: | 86.67 % |
Parental protein coverage: | 57.07 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | LVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAK |
LV.SI.AQSTFNDLQDL.EQIL..KDTDDVPMILVGN.CDLE.ERVVGKEQGQNLARQ.NNC.FLESSAK | |
Retrocopy | LVCSILAQSTFNDLQDLQEQIL*LKDTDDVPMILVGNMCDLENERVVGKEQGQNLARQ*NNCVFLESSAK |
Parental | SKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL |
SKIN.NEIFY.L.RQINRK.P.PGKARKKSSCQLL | |
Retrocopy | SKININEIFYNLIRQINRKIPMPGKARKKSSCQLL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008637 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000008272 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000001086 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000000242 | 1 retrocopy | |
Homo sapiens | ENSG00000127314 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000016460 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000016606 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000001323 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000004590 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000007323 | 5 retrocopies | |
Monodelphis domestica | ENSMODG00000017458 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000005746 | 2 retrocopies | |
Procavia capensis | ENSPCAG00000010977 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004751 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000021148 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000030014 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000015712 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000000931 | 2 retrocopies |