RetrogeneDB ID: | retro_mdom_1756 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 7:237006668..237006983(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RAP1B | ||
| Ensembl ID: | ENSMODG00000007323 | ||
| Aliases: | None | ||
| Description: | RAP1B, member of RAS oncogene family [Source:HGNC Symbol;Acc:9857] |
| Percent Identity: | 86.67 % |
| Parental protein coverage: | 57.07 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | LVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAK |
| LV.SI.AQSTFNDLQDL.EQIL..KDTDDVPMILVGN.CDLE.ERVVGKEQGQNLARQ.NNC.FLESSAK | |
| Retrocopy | LVCSILAQSTFNDLQDLQEQIL*LKDTDDVPMILVGNMCDLENERVVGKEQGQNLARQ*NNCVFLESSAK |
| Parental | SKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL |
| SKIN.NEIFY.L.RQINRK.P.PGKARKKSSCQLL | |
| Retrocopy | SKININEIFYNLIRQINRKIPMPGKARKKSSCQLL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008637 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000008272 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000001086 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000242 | 1 retrocopy | |
| Homo sapiens | ENSG00000127314 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000016460 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016606 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000001323 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000004590 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000007323 | 5 retrocopies | |
| Monodelphis domestica | ENSMODG00000017458 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005746 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000010977 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004751 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000021148 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030014 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000015712 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000000931 | 2 retrocopies |