RetrogeneDB ID: | retro_mmus_3471 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | X:74882033..74882233(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Eif1 | ||
Ensembl ID: | ENSMUSG00000035530 | ||
Aliases: | Eif1, Sui1-rs1 | ||
Description: | eukaryotic translation initiation factor 1 [Source:MGI Symbol;Acc:MGI:105125] |
Percent Identity: | 61.43 % |
Parental protein coverage: | 59.29 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | LTTVQGIADDYDKKK-LVKAFKKKFACNGTVIEHPEYG-EVIQLQGDQRKNICQF-LIEIGLAKDDQLKV |
L.....IADDY.KK..LVKA...KF.CN....E.PEYG...IQLQGDQ.K..CQF.LIE...AKDDQLKV | |
Retrocopy | LLLLSKIADDYFKKE>LVKALRGKFSCNSSISEPPEYG<DAIQLQGDQCKRTCQF<LIETR*AKDDQLKV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 129 .24 RPM |
SRP007412_cerebellum | 0 .00 RPM | 91 .10 RPM |
SRP007412_heart | 0 .00 RPM | 194 .38 RPM |
SRP007412_kidney | 0 .00 RPM | 123 .04 RPM |
SRP007412_liver | 0 .00 RPM | 113 .49 RPM |
SRP007412_testis | 0 .00 RPM | 149 .52 RPM |