RetrogeneDB ID: | retro_rnor_532 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 1:232056001..232056193(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Eif1 | ||
Ensembl ID: | ENSRNOG00000033765 | ||
Aliases: | Eif1, Sui1-rs1 | ||
Description: | eukaryotic translation initiation factor 1 [Source:RefSeq peptide;Acc:NP_001099307] |
Percent Identity: | 100. % |
Parental protein coverage: | 56.64 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | IADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF |
IADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF | |
Retrocopy | IADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 184 .41 RPM |
SRP017611_kidney | 0 .28 RPM | 169 .01 RPM |
SRP017611_liver | 0 .00 RPM | 68 .25 RPM |