RetrogeneDB ID: | retro_mputfur_792 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896948.1:5922823..5923041(+) | ||
| Located in intron of: | ENSMPUG00000011448 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMPUG00000012398 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.73 % |
| Parental protein coverage: | 52.52 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNERYDEIRRHWGGNVLGPKSVARIA-KLEK |
| .ARLG.LVHRKT.TTV.FTQ.NSEDKGALAK.V.AIRTNYN.RYDEIR.HWG.NVLGPK.VA.IA..LEK | |
| Retrocopy | EARLGSLVHRKTRTTVVFTQINSEDKGALAKPVAAIRTNYNDRYDEIRCHWGSNVLGPKRVACIA<QLEK |
| Parental | AKAK |
| AK.K | |
| Retrocopy | AKTK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |