RetrogeneDB ID: | retro_ptro_2238 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 5:26836482..26836844(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | H3F3C | ||
Ensembl ID: | ENSPTRG00000009655 | ||
Aliases: | None | ||
Description: | Histone H3 [Source:UniProtKB/TrEMBL;Acc:G2HIR8] |
Percent Identity: | 63.11 % |
Parental protein coverage: | 88.24 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | PRKQLATKAARKSAPSTGGVKKPH-RYRPGTVALREIRRYQKSTEL-LIRKLPFQRLVREIAQDFKTDLR |
P.K..A.K.....AP......K......P.T......R.Y....E...IRKLPFQRLV.EIAQDFKTDL. | |
Retrocopy | PAKRTARKSTGGKAPGKQLATKAFCKSAPSTGRANKLRCYRPRSEA<TIRKLPFQRLV*EIAQDFKTDLC |
Parental | FQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
FQSAAIGALQEA..A.LVGLFEDT.LCAIHAKRVTIMPKDIQLA.R.RGE.A | |
Retrocopy | FQSAAIGALQEAIKA*LVGLFEDTHLCAIHAKRVTIMPKDIQLACRTRGECA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 121 .81 RPM |
SRP007412_cerebellum | 0 .00 RPM | 340 .56 RPM |
SRP007412_heart | 0 .03 RPM | 83 .18 RPM |
SRP007412_kidney | 0 .05 RPM | 177 .83 RPM |
SRP007412_liver | 0 .00 RPM | 141 .18 RPM |
SRP007412_testis | 0 .00 RPM | 690 .05 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3214 |
Gorilla gorilla | retro_ggor_2181 |
Pongo abelii | retro_pabe_2662 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000012702 | 10 retrocopies | |
Equus caballus | ENSECAG00000006904 | 1 retrocopy | |
Equus caballus | ENSECAG00000016948 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000004118 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000002139 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000008636 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000002045 | 20 retrocopies |
retro_ptro_1045, retro_ptro_1704, retro_ptro_1770, retro_ptro_1867, retro_ptro_1954, retro_ptro_2098, retro_ptro_2183, retro_ptro_2228, retro_ptro_2229, retro_ptro_2230, retro_ptro_2232, retro_ptro_2233, retro_ptro_2363, retro_ptro_279, retro_ptro_2834, retro_ptro_2936, retro_ptro_2978, retro_ptro_300, retro_ptro_3111, retro_ptro_3164,
|
Pan troglodytes | ENSPTRG00000009655 | 12 retrocopies | |
Tupaia belangeri | ENSTBEG00000016171 | 7 retrocopies |