RetrogeneDB ID: | retro_ggor_2181 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 5:71417633..71417995(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | H3F3B | ||
Ensembl ID: | ENSGGOG00000022928 | ||
Aliases: | None | ||
Description: | H3 histone, family 3B (H3.3B) [Source:HGNC Symbol;Acc:4765] |
Percent Identity: | 63.93 % |
Parental protein coverage: | 88.24 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | PRKQLATKAARKSAPSTG-GVKKPHRYRPGTVALREIRRYQKSTEL-LIRKLPFQRLVREIAQDFKTDLR |
P.K..A.K.....AP....G........P.T........Y...TE...IRKLPFQRLV.EIAQDFKTDL. | |
Retrocopy | PAKRTARKSTGGKAPGKQLGTEAFCKSAPSTGWANKLHCYRPRTEA<TIRKLPFQRLV*EIAQDFKTDLC |
Parental | FQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
FQSAAIGALQEA..A.LVGLFEDT.LCAIHAKRVTIMPKDIQLA.R.RGERA | |
Retrocopy | FQSAAIGALQEAIKA*LVGLFEDTHLCAIHAKRVTIMPKDIQLACRTRGERA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 161 .99 RPM |
SRP007412_cerebellum | 0 .00 RPM | 335 .67 RPM |
SRP007412_heart | 0 .00 RPM | 65 .20 RPM |
SRP007412_kidney | 0 .04 RPM | 187 .19 RPM |
SRP007412_liver | 0 .00 RPM | 175 .20 RPM |
SRP007412_testis | 0 .00 RPM | 607 .82 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3214 |
Pan troglodytes | retro_ptro_2238 |
Pongo abelii | retro_pabe_2662 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000009661 | 10 retrocopies | |
Gorilla gorilla | ENSGGOG00000022526 | 11 retrocopies | |
Gorilla gorilla | ENSGGOG00000022928 | 7 retrocopies |
retro_ggor_1964, retro_ggor_2181 , retro_ggor_2198, retro_ggor_2357, retro_ggor_2805, retro_ggor_2905, retro_ggor_2987,
|
Loxodonta africana | ENSLAFG00000021624 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000015447 | 10 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000024644 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000008636 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000024226 | 8 retrocopies | |
Tupaia belangeri | ENSTBEG00000006177 | 13 retrocopies |